GenomeNet

>sbi:SORBI_07g014960 SORBIDRAFT_07g014960, Sb07g014960; hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MAGKLEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGEDLRELVQECY
EIAAEYERKHDSEKLDELGNMLTSLDPGDSIVTAKAFSHMLNLANLAEEVQIAYRRRIKL
KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSL
LQKHSRIRNCLVQLCSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMS
YFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANLYCSQIENLMFELSMWRCNDELRAQADELHRSSKKDAKHYIEFWKKVPP
SEPYRVILGDLRDKLYNTRERARQLLSSGYSDIPEESTVTNVEQFLEPLELCYRSLCACG
DRVIADGSLLDFLRQVSTFGLCLVRLDIRQESDRHTDVLDAITTYLGIGSYREWSEERRQ
EWLLSELNGKRPLFGPDLPTTDEIADVLDTFRVIAELPADNFGAYIISMATAPSDVLAVE
LLQRECHVKTPLRVVPLFEKLADLEGAPAALARLFSVDWYRERINGKQEVMIGYSDSGKD
AGRLSAAWQLYKAQEELIKVAKKFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALLDEMAVVATKE
YRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGAAFKHILEKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDKL
LVSSELWPLGEKLRANYEETKRLLLQVAGHKDLLEGDLYLKQRLRLRDAYITTLNVCQAY
TMKRIRDPDYHVTLRPHLSKEIMDWNKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG

BLAST