GenomeNet

>sbi:SORBI_07g018230 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) SORBIDRAFT_07g018230, Sb07g018230; hypothetical protein (A)
MAASGEGASLPSPAGGEDAHRRRVSYFYEPSIGDYYYGQGHPMKPHRIRMAHSLVVHYGL
HRLLELSRPYPASEADIRRFHSDDYVAFLASATGNPSVLDPRAVKRFNVGEDCPVFDGLF
PFCQASAGGSIGAAVKLNRGDADITVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKFH
RRVLYVDIDVHHGDGVEEAFFTTNRVMTVSFHKYGDFFPGTGHITDVGAAEGKHYALNVP
LSDGIDDATFRDLFQCIIKKVMEVYQPDVVVLQCGADSLAGDRLGCFNLSVKGHADCLRF
LRSYNVPMMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNDYYEYFGPDYILHIQP
KSVENQNTTKDLENIKNMILESLSKIEHVPSTQFHDRPSDPEAPEEKEEDMDKRPAQRSR
LWSGGAYDSDTEDPDNLKSESKDVTANLQMKDEPKNDL

BLAST