GenomeNet

>sbi:SORBI_07g019860 SORBIDRAFT_07g019860, Sb07g019860; hypothetical protein; K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] (A)
MDSYAARLDVARQPRLPVPGPAAGRVGRACPPQRADHRGRPPASPRGCGGDTRRAGGLRE
HGVVAAAVAATAIAAGSVGDDAAAGVAAAMVAREETGGSEVGSKRCLPLAAAHPPPKRRA
VSARRRFPPQCGRNVAAPLATANNASRFGDAGAEVCSAVLDLEKTAASSPLAGGKDGALL
GAVSPVSAATSLVKQLCAVDGDAPMADGGHHGPQPGVVKSSEALRRSGGTAVDGLLDGGS
QGVAAVSMEDRGKGAWSGELGRKELVPDAHLQANPRMSLDERSFPLGYGKDAVLSLLLAG
GSSKVCLPLKSRPTDKLGVLEEAVVATHGCISSVQGHYIKIVSNDGTVQDYELEDGEIPP
ELVVQESQVSTGVALHESTDCRHGPSVPEVNAKETFAMQPCNEKTGGDTLQCGEKISSYL
VANDVEVVNKSIGSSVNVVAASLAEDLSKQNMVGKRVSESAMMNIVDVTAGGCGNGTTMR
CVTMHDSAACRHGDSVPEISAVETSVMQSSNEKTGGNILQCGDKKSSCLVTKDIEVMNKS
IRISCTAVAGPLAEDSFKQNLMGKRVSESARMNRASDDVAAATSGNSIMMRSKVRFTPRK
VIKLSKVIQKSTLDTRHRHCPEDREKETELSRRGIINKIEDTDKLTKDRVLQAPMTQEKE
AATTRGFFGPRKRVKVKVPAHLQMKIASTCALGCKVKLDDKVASSLDDDDILKALVVNEG
NLELFLNSYSSLTSARCQMKHGSQNADARSKFKMLCRRFEFVCRALVQAVEQNSLKIRRI
DLQADRVIRKLPGFTKSGPIVGQVPGVQVGDEFLYRVQLAIVGLHLAYQGGIDTTIYRNG
ERIAISIVASGGYPDELSSSGELIYSGSGGKPAGKKDHEDQKLERGNLALKNCIKTKTPV
RVIYGFKAQNNRVGSHSRAREVSTFTYDGLYRVLDFWMDGQPGSRVFKYKLKKIPGQPKL
PMHMAEGMRKSKTRPGLCEIDISQGKEGIPICVINTVDTERPAPFRYTTRIRYPFELTKK
RHQGCDCTNGCSDSVSCACAVKNGGEIPFNLNGAIVNEKPLIFECGPSCKCPPSCQNKVS
QHGLKIPLEVFKTTKTGWGVRSLRSISSGSFICEYVGELLYGNEADERRNSNFLFDIGLN
HGDENFCNGLLSDVSDMKSSSSSSQILGDVGFTIDSAECGNIGRFINHSCSPNLYAQNVL
WDHDDLRIPHIMFFAAETIPPLQELTYDYNYEIDHVEDVNGRIKFKVCQCGSSGCSGRLY

BLAST