GenomeNet

>sbi:SORBI_07g019863 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) SORBIDRAFT_07g019863, Sb07g019863; hypothetical protein (A)
DARSKVRKLLQLYRVTCQKLTQVEVQGNPIVGRIYLEAAKIVKKDPIYAKLGAIVGNIPG
VEVGDEFYYRIELAIVGLHRLHQGGIDTSKVNGVPIAISVVASGGYRDELSSSGELIYTG
SGGKAGGNKDGDDQKLEWGNLALKNCIETKTPVRVIHGFKGQNRSEFGKETSTFTYDGLY
EVVECWREGPKGGMVFKYKLWRIAGQPKLTLHVVKAIRKSKSREGLCLPDISQGSERIPI
CVINTVDDMRLAPLKYITKLTYPTWCEIVPQNGCNCTNHCSDTIRCSCAWKNGGEIPFNC
DNAIVKAKRLIYECGPWCRCPPTCYNRVSQHGVKIPLEIFKTGKTGWGVRSLSSISSGSF
ICEYTGELLKGEEAENRQNDEYLFDIGRNYYDEELWEGIPPVVDVQSSTSSSGTMKGFTI
DGAECSNVGRFINHSCSPNLYAQNVLWDHGNMKMPHIMLFAVENIPPLQELTYHYNYKVG
SVHDENGNEKVKHCYCGASACRGRLY

BLAST