GenomeNet

>sbi:SORBI_07g023560 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) SORBIDRAFT_07g023560, Sb07g023560; hypothetical protein (A)
METSPPPPPPPPPPPQIDHLLSQFPIIPKPDPDGPTPAQTPAPIAERSAALMLALTPELC
QVLHRELAPSPDDDPYFARCLRQSQLHLEALAASLRPPSSSSSSSSAAAAAASLARVLPP
PPPPQKELRTQLQREPGAGGGSNPSSSKKRARASTEVVRATHLSPADHLRYRALVRRARL
TFEALRSTYQRQETSSGVRNRHDLRASRQMLSAGHWLHREVRIVGDIPGVFVGDAFYYRA
EICVVGLHTMPQAGIGYIPGSLLNEGDPVATSIVSSGGYLDDEDTGDVLVYTGSGGRQRN
RVDHHANQTLERGNLALHNSYLYGVEVRVIRGHDIDQGPHRKVYVYDGLYRVIESTFGPG
KSGHDVCKFKLVRLPGQDDLASKTWHTAKLLKESMDARIRPPRYISLDLSKGAELLRVPV
CNKVDNDRSPLLFEYIAQPEFPVRPAHVPVKQHGGCHCAGGCGSKCRCERKNGGEPVYTE
DDILVMGRPVVYECGALCGCPMTCVNRVTQRGMKHRLEVFRSIETGWGVRALDLIQPGAF
VCEYTGHVVVMDDQPGSALEGRSIIDPRRFPERWKEWGDASAVEPNMKRLQFAKFAGPGY
VLDVSHKRNVACYISHSCTPNVFLQFVLRGNEDESFPHLMVFAMETIPPMRELSIDYGID
MELSAI

BLAST