GenomeNet

>sbi:SORBI_08g004840 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (RefSeq) SORBIDRAFT_08g004840, Sb08g004840; hypothetical protein (A)
MDAAVAAAAEARERVRASFATGRTRAAAWREAQLRGLLRMAAEMEDDVCAALRADLAKPQ
TESYVHEISLVTTSCKFALKNLKKWMKPQKVPGGVLTFPSAARVTAEPLGVVLVISAWNY
PFLLAIDPVVGAIAAGNAVVLKPSEVAPATSSLLAELLPRYVDASCVRVVQGGIPETTAL
LELTWDKIFYTGNSKVGRIVMSYAAKHLTPVVLELGGKCPVVVDSNVNIHVAAKRIAAGK
WGCNSGQACISPDYIVTTKSLAPKLLESLKKVLRKFYGEDPLRSPDLSRIVNSNHFNRLR
TLMDDGTVAGKIAFGGQSDEQQLRIAPTLLLDVPLDSAIMKEEIFGPLLPIITVDKISES
FAVINSVSKPLAAYLFTNDSRLKQQFERNISSGGMIFNDTAIHLTNPHLPFGGVGESGMG
AYHGAFSFDAFTHRKAVLDRSSFLGEARARYPPYTPAKLGILRGVLKGNPLAMVLAAVGY
TGGRRRA

BLAST