GenomeNet

>sbi:SORBI_09g005840 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) SORBIDRAFT_09g005840, Sb09g005840; hypothetical protein (A)
MVAAAAERVVAELREACAAPAARLNEVAAAMEAEMRAGLREEGGSKIKMIISYVDNLPTG
NEEGVFYALDLGGTNFRVLRVHLAGKDKRVAKRESKEVSIPPHLMSGNASELFGFIASAL
AKYIASEEGHSNVFDDDKQRELGFTFSFPVRQTSIASGTLIKWTKAFSIDDAVGEDVVAE
LQTAMEKQGVDMRVAALINDTVGTLAAGRYNDEDVVIGVILGTGSNAAYVEEASAIPKLE
GELPKSGNMVINTEWGNFDSSCLPITEYDEALDEESLNPGEQIFEKLISGMYLGEIVRRV
LLKIASQSSIFGNVSHTLLKTRFILRTPDISAMHHDDTPDLRIVAQKLADNLKIMDTSLD
TRKMVVEICDIVTSRSARLAAAGIVGILRKIGRAVPGDERRSVVAIDGGLFEHYAEFRKC
LESTLVELLGEEASKSLVVKLTKDGSGLGAALIAAAQSQ

BLAST