GenomeNet

>sbi:SORBI_09g024010 SORBIDRAFT_09g024010, Sb09g024010; hypothetical protein; K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] (A)
MYRASNFVPDPNQVLLDAKPLRSLAPMFPAPMGVNVNQSSTPPLVCVTPVGQFPAGFGAG
NLPAFGSFTTFSATANGVSYTGTSANGAIDATPISAYKTRTGISLGDDELYSGNQTLVTK
RKRGRPLGSGRNGPNGKVKRPKPTYKNFVAGKELAFLSSSSDPREIVESVHMAFEALRRR
HLQMDETQDASRRADLKAGAIMMASNIRANTGKRVGTVPGVEIGDIFYFRMELCVLGLHA
PSMGGIDYMTTKFGNDEESVAICIVSAGGYENEDDDTDVLVYSGQGGNSRNTEERHDQKL
ERGNLALERSLHRKNVIRVVRGFKDPFCLTGKIYIYDGLYKIHESWKEKTRSGINCFKYK
LLREPGQRDGAALWKMTQRWIDNPATRGRVLLADLSSKAEALPVCVVNDVDHEKGPGEFT
YTNQVKYSRPLSSMKKLQGCGCQSVCLPGDASCACGQHNGGDLPYSSLGLLSCRKPIIYE
CGESCNCSINCRNKVTQKGSRLHFEVFRTTNRGWGLRCWEPVRAGSFICEYAGEVIDELR
VNLNDCEDDYIFQTVCPGEKTLKWNCGPEMIGEESTYVSSDEFEPLPIKISAKNMGNVSR
FMNHSCSPNVFWQPVQYDHGDDGHPHIMFFALKHIPPMTELTYDYGVAGAESSGPGSRRT
KNCMCGSQNCRGLF

BLAST