GenomeNet

>sbi:SORBI_10g001280 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (RefSeq) SORBIDRAFT_10g001280, Sb10g001280; hypothetical protein (A)
MASTALVAVAVGGGLCPGLVASCSVASCSLRAGGGDSPRLGRRLVLLQRGGGAEGERKRI
RNCPIFRCANEVDVVTEDDNVDGDATDDEEDLEAAADDAIDADVDTEDELDSSLPEDVEW
IKQQPLPYPLDALEPYISKETVGQHWGVHQQIHVDRLNGMIGGSEWEGMSLGQMMLASFN
EGREQPHPPFFHAAQVWNHDFYWRSMKPGGGGKPPERLLKFINRDFGSYEGMIRQFMDAA
LTQFGSGWVWLSYKGSGLPYVKSRSPIASDNYGRLVISKTPNAINPLVWGHSHAYYLDYE
DRRADYVSAILENLVSWEIVESRLTKAVVRAVERDEDLRRRIQRKQHLSQANGQSRARPR
TRQGRPTGWQGDQEVARSSPVEA

BLAST