GenomeNet

>sbi:SORBI_10g022550 K11418 histone deacetylase 11 [EC:3.5.1.98] | (RefSeq) SORBIDRAFT_10g022550, Sb10g022550; hypothetical protein (A)
MASSSSPAPTLAGEALRQKRILSSKLYLEVPSSKAPVVYSPAYDISFLGLEKLHPFDSAK
WGRICRYLTREGYLDKKRMVDPLEACKEDLLVVHTEAYLNSLKSSFRVSNIVEVPPVSLV
PNWIVHKKLLYPFRKQVGGSILSAKLALERGWAINVGGGFHHCSADEGGGFCAYADISLC
IQFAFARLNISSVLIIDLDAHQGNGHEKDFANDGRVYIFDMYNAGIYPFDFTAKQYIDQK
VELASGTETDEYLEQLDKALEVCNSRFQPQLIVYNAGTDILDGDPLGRLKVSPEGVVTRD
EKVFTFAKDQNIPLLMLTSGGYMKSSARVIADSIINLSNKNLIGLGSELG

BLAST