GenomeNet

>sbi:SORBI_10g022550 SORBIDRAFT_10g022550, Sb10g022550; hypothetical protein; K11418 histone deacetylase 11 [EC:3.5.1.98] (A)
MASSSSPAPTLAGEALRQKRILSSKLYLEVPSSKAPVVYSPAYDISFLGLEKLHPFDSAK
WGRICRYLTREGYLDKKRMVDPLEACKEDLLVVHTEAYLNSLKSSFRVSNIVEVPPVSLV
PNWIVHKKLLYPFRKQVGGSILSAKLALERGWAINVGGGFHHCSADEGGGFCAYADISLC
IQFAFARLNISSVLIIDLDAHQGNGHEKDFANDGRVYIFDMYNAGIYPFDFTAKQYIDQK
VELASGTETDEYLEQLDKALEVCNSRFQPQLIVYNAGTDILDGDPLGRLKVSPEGVVTRD
EKVFTFAKDQNIPLLMLTSGGYMKSSARVIADSIINLSNKNLIGLGSELG

BLAST