GenomeNet

>sbl:Sbal_2356 periplasmic binding protein/LacI transcriptional regulator; K01775 alanine racemase [EC:5.1.1.1] (A)
MASKATSIDIAYRAGVSQSTVSRALRNSPLVNLETRQRIQAIAKELNYKVDKNASNLRTQ
NSHTLALLLCEDPTNDDSLINPFFLSMLGSITRATAQQGYDLLVSFQQLSSDWHADYEDS
NKADGIILLGYGDYMDYEQKLERLLAQNTHFVIWGAEHNNKSVLSIGCDNHQGGLIATEH
LISLGRNAFAFLGDASSHSPEFRDRYLGHVKALQTANIPVDRTKQVSAISTESSGYDAAM
VLIAQGAKFDAIFAASDLIAIGAIRALKEKGISVPEQVAVVGYDDIPVASFANPPLTTIK
QNTQLAGEILVDSVLKLIRGQEVSAQLIPTTLVVRSSCGIDSAPLKPL

BLAST