GenomeNet

>sbl:Sbal_4532 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (GenBank) hypothetical protein (A)
MVISLNRRSKIALTVALALGLTACNDAQSKTDKSASTEAAVINTAPDKTQAIAFINDAEA
KMAELSIESNRAEWIYSNFITDDTAALSAAVGEKVSAASVKFATEAAKYANVQLDPVNAR
KLNILRSALVLPAPLDPAKNAELAQISSELNGLYGKGKYCFTDGKCMTQPELSSLMAESR
DPATLLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDDFSQE
LDRLWGQVKPLYESLHCYVRGELNKEYGDNIAPTTGPIPAHLLGNMWAQQWGNVYDLVAP
DNADPGYDVTELLAKNGYDEHKMVKQAEGFFTSLGFAPLPESFWARSLFVQPKDRDVVCH
ASAWDLDNIDDIRIKMCIQKTAEDFSVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAI
GDTIALSITPSYLKQIGLLDEVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGE
ITPAQYNQAWWDLREKYQGVKAPTKRSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHQ
ALCETAGDKGPVHRCSIYGNQAAGEKLNKMLELGLSKPWPEALKEVTGKETMDAKAVLDY
FAPLKTWLDEQNTAANRQCGW

BLAST