GenomeNet

>sbn:Sbal195_3819 Glutathione S-transferase domain; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MKLLSSQASPYARCVRALIQYLGINNIEELLVNPFENSAELLDANPLGQIPCLITNDGVA
LFDSEVIMRYLDAELGDRKMFGISSHNWVLECQYSLIKGLIDSAVKLRQEQMREDEGVRS
AFWTARFEQALLRGLMQVELQTVITQTTIQAPQLALICLLDYVDFRHPELDWRKVAPATA
LWFSEMRDLPAFIQTRPQ

BLAST