GenomeNet

>scb:SCAB_24181 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) putative thimidine kinase (A)
MPKGAQLTMPELVFFSGTMDCGKSTLALQIEHNRSARGLQGMIFTRDDRAGEGKLSSRLG
LVTDAVEVEDGQDLYAYLVDHLSQGRRADYVIADEAQFLAPEQIDQLARVVDDLSLDVYA
FGITTDFRSKLFPGSQRLVELADRVEVLQVEALCWCGARATHNARTIGGQMVVEGAQVVV
GDVNQPDDIGYEVLCRRHHRRRMTAASAHASALAPDVLPVETV

BLAST