GenomeNet

>scf:Spaf_1029 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase, putative (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKSVVIMTSAIDTRDGVGVVSSRIGMKREAV
AIEDDTDIFGFIKNQAIKPYCVLIDEAQFLKRHHVYDLARVVDELDVPVMAFGLKNDFRN
ELFEGSKHLLLLADKIEEIKTICQYCSRKATMVLRTQAGKPVYDGEQIQIGGHETYISVC
RKHYFNPDINQEKKS

BLAST