GenomeNet

>sch:Sphch_2017 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase domain protein (A)
MWQLFQFPLCPFSRKVRLLLGEKGVGYDLMRESPWEARDEFLDLNPAGTTPVMVDEEKGM
TLIDSQAICEYFEETVEKFPLISGTAAGRAEVRRLTAFFDQNFYGDVVGPLLHERMKKRL
IERAPPDARVLREAMKRANVHMDYMDYLLDHRSWMAGPTLSLADIAAAAHLSVADYLGGI
DWAGHETVKRWYAGFKSRPSFRPLLSERMEVITPPPHYEKPDF

BLAST