GenomeNet

>scl:sce0183 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst1; Conserved hypothetical protein (EC:2.5.1.18) (A)
MTELLGLVFSPWTEKARWALDVRRVPYTFRHYQPLVGEPALRVKLRRLTGRVSVPVLTTD
DGRVLGDSADIARWADGRGAGPTLFPVEHEADIARLIDLSERGLAAGRARALRRMLADDE
ALAEMAPRPIRRALAPLASRLGALGVARTLRKYEGDKADGEAHRQTQVAVLEEIRETLAR
AAPPGDAPRTLLGRFTFADIAMSQVLVNVAPPAQLKLGAASRRCFSDPDLRDRYDDLIAW
RDELYRAFRTS

BLAST