GenomeNet

>scl:sce1125 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst3; putative glutathione S-transferase protein (A)
MTTPILYAHPFSSYSQKAFIAFHEKDVPYELRLLEPSNPQAGAELAALWPLGKFPVLRVG
DLALWEATIVVEWLDQAHPDPARLIPRDPDAALQVRMFDRIFDNYVMNMMQVIVNNRIRA
MQSNPRDEYGEVQARAALDKVYAWLDGELAGRTWATGDAFTLADCAAAPSLFYADWVHPF
DDRPNLRAYYRRLRERPSVDRAVEGGRPYRHYFPGGAPADRD

BLAST