GenomeNet

>scl:sce3427 ppc; hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MPPRRREVDRPLRKEVRLLGRLLGEVLIEQEGEELFAIEERIRTLAIRRRRGPSDGRAHA
AAELSKLLAELPHDRLEPVIRAFTVYFRLVNLAEQHHRIRRARAYATDPGARPQRGSIEA
AMHTLKKAGVPAERVRAALRTLDVTLTLTAHPTEAARRTVLEKLYRIAKNLEERDRCQLT
PDESARKLAEIREEITALWQTDEVRRDRPTVGDEVKNVAWYIEEILWDLLPDLPTVIGRA
FEAAYGEPLDAEIAPLRIHSWVGADMDGNPLVVPAVLEDALFAYRIRGLRRLVRAVRDLG
GALSQSVRHVTPPPWLLASIEEDAAAMPEVAAHFGPRTEGEPWRRKLHFIEARLTATLEH
AEHGRAEARARSGQGPAREGRAFVRPEEPTLAVPYREPAELERDLAVVADSLRAARCASS
GERRARALLSQVRALGFALAELEMRAPAEDARAAAASLAEGRVEPAQMTPEARRVFEALQ
RIAAAQRDGGESSCRTLVLSMTHSEDDVLAALASAKAAGLWDEARSCARIDVVPLFESLA
ALNDSARILRALLAHPEYRPHVLARGVQEVMIGYSDSGKEVGLLAASAALRRVQETLPKI
AAEAELPLRVFHGRGESVARGGGPAHQALLALPAGSVGGRYKATEQGEALDHKYARPELA
MRTLEIMLSGVLLHTLGAQPRPPAASELRYAAAFDELAETGRRAYRALVWEEPKFVEFFT
AVTPIDEIARLPLGSRPSKRRAGGLESLRAIPWVFAWTQNRAILPGWYGVGSGLEAMGQR
PEGAELLKEMMASWPFFRAVIDNVEMVLAKADMTIFAGYAELAPAAARKAVAPRIIAEYK
RTRSWLKRLTGNRRLLEGNPTLQRSISLRNPYVDPLSFLQVELLRASRGGDSGRDRSLLL
TLNGIAAGMRNTG

BLAST