GenomeNet

>scl:sce3979 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (GenBank) unnamed protein product; Family membership (A)
MVRIPMFVVALPCGMLALTAACSDPAPPTPPQPATDPAAEEAARFIDAAEAELHELSTYN
NRAAWVAATYITVDTEILAAAASAKLLGVQADYAKRAARFLDLDLPYDVRRRLELLRTSL
TLYAPADPAKTKEVATIASRLEAMYGAGKYCPASGECLTLEDLSRTLAKSCDPEELKRAW
VGWHTVSAPMRGDFTRLVQLANEGARELGFKDTGDAWRSKFEMRPGVLSREVDRLWGQVK
PLYDALHCYARGRLAAKYGEDVAPGKGPIRADLLGNMWAQDWSNIYDLMEPEGAAPIYDL
DAALQAKGYTPIEMVKTGERFFVSLGFEPLPATFWERSLFVKPADRDVVCHASAWNIDDE
EDLRIKMCIEITAGDFQTIHHELGHTFYQRAYNQLPLLYRDSPNPAFHEAIGDTIGLSVS
PEYLQRIGLVDQLPPASSDLSLLLREALGKIAFLPFAVSVDRWRWGVFSGDIQPAAYNKA
YWEIRRRYQGVVPPVPRSESDFDPGAKYHVAASVPYIRYFFAHILQFQFHRALCDAAGYK
GPLHRCTIYGSDKAGERLRRMLEMGRSRPWPEALEVVTGSRRMDAAALLDYFGPLKDWLD
QQNRGKTCGW

BLAST