GenomeNet

>scl:sce8848 gst19; hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MANNTLTVHHLGRSQSERIVWLCEELGLDYALKRYERRKDNRMAPPEYKALHPMGTAPIL
TDGQLALGESGAIADYLIATHGEGRLAVQRGQPGFADYLYWFHFANGTLQPAVLRVWYLE
RVDASEKNAALHAAKDRFNLIFSTVDQRLGEAPYLAGPELTAADIMTVFSLTTMRLFKPY
DLSPWPNILAYLQRIGARPAYRRAMQKADPDMTPLLGATP

BLAST