GenomeNet

>scm:SCHCODRAFT_11038 hypothetical protein (A)
MESFIRRLSTNDLKTSSNGSANGSAASGSAQPNGSVADTGGNKYTKYVRATEQQPSLFNE
QRLFGGYQPPSSVTAVADMMLHKESLDDRKLFLEHGLKFISGTLEGDMQMKAQNTVIKKL
YDDLPHPPATALGCEYAWRQPDGSNNNMDLPHLGQAGKPYARSVQQSHPLPSHQLPDPGL
IFDTLLKREKFVEHPAGLSSLMFGFAALVIHTVFRTNHDDVNINETSSYVDLAPLYGNNQ
ETQDRVRDKSQGRGLLHKDAFAEDRLLLLPPATCAILVCFSRNHNFIAERLLEINERGSW
QQDLDKLDEEGKAKQDEEIFQIARLVNCGWFGSAVFADYVHCILGLVRQGSSWTLDPFSE
LRKEDHSLFERGKGNVCSVEFNCLYRWHATTSVHDEAWVEKVMTSQFPDKKIEDITPRDF
KECAVKLMQHAGPDLTHWTFGNMQRGEDGSFDDEQLADILHNATEQPAGAFRARGTPGVM
RLHEIMGIEQNRKWGVCSLNDFRRFLGLKAFDTFEDWNPDPEIANAARALYGDIERLELY
VGLQAEDAKPVVEGAGLCPGYTISRAILSDAVALTRGDRFFTHDFTPFNLTAWGFADCQR
DDMAHGFGSVLARLFLRTLPGQFTEDSVYGFFPLMTPQAMGVVLKRLGKEADYSLARPEP
AATEKVVTTHDGVRAVLTSDAYVSPTGTRARKVRGKDGMTFPLVLTGREQQAQICKVFQA
PEIAAGVADYFKTTTRHLLDLHGCPLPGTRHYVIDVVRDVLKPLPALWAANELAGIQLKE
TKDGEGVYTVEEFYSMLSETYEFIFLDIEASRYKTVECRVRKHVEELIGHITSHLNNTFP
QKVISTIMSKMPWAKGSKKSEHDELVRRLQLLAPSSSALADTILAIIISVVDISLGLTNV
VNAYLGPHKVTEPVPPHVDAFIKAAKPEQLEGFILEALRHDPPTRCMQRTAVSGHVVENI
RVEAGARLFLDLEQANKDEAVFSSPDEHRIGRPKEKHLFGEGSITILGQDMVHKIYAEVL
TVIFSHPNVRRTVGQSGMLQRFKTVERKALNYAYLDAKMMVSPWPSSMMIQYDV

BLAST