GenomeNet

>scm:SCHCODRAFT_114799 hypothetical protein (A)
MSIIQRLAGGADFVLASTAPVDTDGGKPRPRYVVGQKLDELVQYLKNPPAQLDSLVSISI
PYILDAKLTKCSEPAYLDAVKHMHSGLDDRKLLPAQLEHLLTLMARLGSGNDFSSRVQEA
VIDLLYKDLPHPPACYLSVLHQAGLNLNVPLANVNYAYRTADGSYYNPLFPTLGMAGTPY
ARSVPSANCTPLNNLPDAGLVFDTLLRRKEGTFKEHEGGMSSLFFAMADLIIHCIFDTDH
KDITKNNTSSYLDLSILYGNSEEQLNGVRRHDGTGRLWDDVFADRRLLLMPPSTCALLVL
FCRNHNHIAQRILDINEKGKYRSVDSFSDDARKAQDDEIFHRARLVNCGFFMQVILADYV
GAILGLVRDGLPWRLDPLMTMRRESHEFSPQGEGNVVSIEFNLLYRWHAALSAQDTKWTE
GLFKSVFGQDVDFDKVTPTDFKRVVGRMFGQPQDPRTATFTDYAGQRLERHPEEGAATPD
GAGRFADADLARVLQDATSWRAGSYGARAIPAALRVIEVMGIEQSREWGTCSLNEFRHFM
GLKKYDSFKDWNPDPVVHKQAETLYKDINNLELHVGMQAEAIKTPGPGAGLCPGYTISRA
ILGDAVALTRGDRFLTTEYTPNNLTRWGFKYSHVDPDDGSVGGILPRMLLATLPDHYPSG
SAYTHFPFLEPAYIRNEMRKRGDKNLDRYTWDRPAVPAPLTVISTWAEAVEVLDTQKARF
VSSYPQRLKDVTGVDADSKLLARKTLLRLAPRLPAYFASKTMELINASPVTYVDADTKTV
DIGRHVINLLPVHWISQQLACIALKTESNPLGTEYESDVCDMFENVCRYVYLDNDTYNHF
RLQTDARKAFEHLTSFTARKLRAMTGSRISVSGITQTLSRFILKEDDSTPFLRALLEGSD
GADADTLAAHLFAEVVPTAAHFSRIVMQVVDFFLGSDEEGDEKRQAREAIVALASQCTAE
ADKQVMKYVDEALRLEPAVSGVYRTASAAAVVGNQRIEAGQRVYVALSAAKQDSSVFGAD
TSTADFKRSTPSSTRLGLPDSGLLIPQLFDRILPRVLGVIFGLKNLRRAPGQSGVMSSFT
QTLHGAPEKLFFDFDGNVTPIPESLFVEYDF

BLAST