GenomeNet

>scm:SCHCODRAFT_46359 hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
QGSGTFFAMPKSAKATPPQQASLKEMWGKKKASTSAKSAKDASDSANSEVKPSKPASGAC
AYTEDELRPETSTGEKTAKAIESDDEEAPTSSQKATSKKTSLKQTKTKKDKATAADSKSE
GRRRPKKASEKAAPATSDAEPDAEASVPPSSDVEAAEEEEDEDDEALLEDEEGEGAATRA
VAAKAAEAALARTSDVDIKGGWKVGDPVPYAALTKTFSHIESTTKRLEKNAFLTAFLTLV
IQRSAPNDHNSLLQAVYLCINRLSPDYIGIELGIGESLLIKAISESTGRNAGLIKADLKK
EGDLGLVAMNSKNSQRTLFKPKPLTLPFVFSNLKEIALSSGHSSQTKKVSIITKLLAACQ
DFEAKYIVRSLEGKLRIGNAERSVLVALAHAAVLAENAKRDRKLHGEKLAARLEESTNIV
KAVYSELPSYDKVIPALLDHGIDGLREHCKLSPGVPLKPMLAKPTKAIGEVLDRFENKRF
TCEYKYDGERAQVHLMEDGKIAVFSRNSEDMSKKYPDLMEQIPRCIKDSTKSFVLDAEAV
AIDRTTGKLMPFQELSKRKRKDVKVEDIQVKVCLFAFDLLYLNGEPLLQKSLAERRVLLR
ESFQIVESEFQFAKSTDSETVEEIQTFLEESVKDGCEGLMVKMLESDASYYEPSRRSINW
LKLKKDYLAGVGDSLDLVVVGGYYGKGKRTNVYGAFLLACYDADSEEYQTICKIGTGFSE
EALQSHYNVLKPLEMEKPRGDIKVGGAKPDIWFEPKVVWEVLTADLSLSPVYTAAMGLVD
ERGISLRFPRFIRIRDDKNADNATGCEQVAEMYERQALAQGGGKKGKVVDDFW

BLAST