GenomeNet

>scm:SCHCODRAFT_53697 K10777 DNA ligase 4 [EC:6.5.1.1] | (RefSeq) DNA ligase IV-like protein (A)
MQATPAPTEAPGSPQPSQTTASQQPFPEQPYNTDTLPFHILTAFFEKLQGERKQEKRRKL
LNHWFNKWREDNGPDLYPVLRLILPHRDRERNVYGLKEKALAKLYIKVIPLNKNDPDAMR
LLYWKKPTEKHASTCASSAASGDFPTVLYEVVSKRSSVTQSTLTIDDINDMLDQLADMSN
KSEKQSKIIQRLYNEATPEQQLWFARIILKDMNISVKETTVFAVFHPDAQALYNTCSDLK
KVAWQLADPSIRLHEDEKQVKLGQPFMPMLCKRPMKRIEDTAQEMDGSEFIIEEKLDGER
MQLHKMGNQYYYSSRKGKDYTYLYGSHVGAGSLTPYIAHRFHKQADSAILDGEMLVWDPI
SGRNLPFGTLKTAALDQSKKQAAPRPCLKVFDLLYLNGKSLIDKSTAFRKKNMRLVIEAL
PGRIEFVDEFKGRTAQDIREKMDEVMANRGEGLVIKHPKSQYVLNGRNNDWIKVKPEYMD
NMGETVDVLVVAGNYGSGRRSGGVSTLICAVFDDRNTGSFNENESKYATFVRVGSGLTYA
DYMWLRAKNWKTWDAKNSPTYLQTAKRSHEDKGDVYLEYEDTFILKVKAAEITPSDQYHV
RYTMRFPRALSIREEMAPGDCMTASAVVEQLKTAKKRKMETNKVSSTKKRKVVKKKVEML
PRFDGPDMKDVKEESDLFKGMKFVVISDPKARTGEEDRKKLMKLIRSHGGQCPQFAKDPA
AIVVYNGTSTPYDLQLIIRKDTNDVVRPQWVMDCIAKGELVPMEKKYFFFATTARKETAE
YGEDGGAESSGSVTQESSDDEAAAETSQSSKKRKRAGKSAEPETQDKTADEEKATPAPSK
PKVDLDPGLAAWLGYDEDDAAGVEDDAGEKDERGGRDDVESDNDSDNQDVKDEEEEDDMA
FWFNEDDGDDSATATLPTQKTTQSTADTQKGDDAPTTQPEVKMGDDNAMHYDEELIFKYL
CFYLDSPSNARASGMSVKSTAHEDEINESFEELRSKIESNGGRVVDLSEPKLTHVVLDKR
DLSRRIDLMRRTSKPKRRHLVLTAYIDACLEENTLLDEDGELGHA

BLAST