GenomeNet

>scm:SCHCODRAFT_54510 hypothetical protein; K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] (A)
MAPFITKFEPFEPTEFVVDKEAGTRSPAKLEKVAIVGSGSWGTALARVAAINAANLEGFD
DEVRMWVREREVPGKGKLTDIINSTHQNERYLPNVELPENLVAVSDLKEVVKGATLLLFV
VPHQFLPNVLKTLKEPGVIDPRARAISAIKGVDVELREDGADIYTYPFVIEKELHIPCSA
LGGANIALDVGKGEFCETTIGVPSPKDAALWHAVFDGPAFRVHPIEDVAGVSLSGALKNV
VAMAAGFVDGMGLGGNTKAAILRHGLIEMSNFTLEFFPSASPLTFSHHSAGMADLITTSF
GGRNRKCAEAFVRAKMEGKPKTFQQLEEELLNGQKLQGVETAREVFEFLQARKRLDGYPL
FEKVYRISFEGMDPKRMFEDL

BLAST