GenomeNet

>scm:SCHCODRAFT_61980 K00814 alanine transaminase [EC:2.6.1.2] | (RefSeq) hypothetical protein (A)
MRPLSTSDLNPAILKVEYAVRGELAIKAEEYRKRLALGGEHGLPFDKVISSNIGNPQQKG
LDQPPITFIRQVAALCEWPALEELAPNAFPKDVIARARELREEIGSVGAYSHSQGVPLIR
QSVANFIEERDGYPANPDHIFLTGGASAGVSLLISMLITPPNTGILIPIPQYPLYTATLA
QHHGVPLPYHLDEASGWSTSLHEIEATLEHPQHAEITPKALVIINPGNPTGALLDEATQE
KLVHLCEKHNLVLLADEVYQTNLHRPDEHPFVSFKQIVSRMKSKVPLVSFHSISKGVTGE
CGRRGGYFECVNFPDDILALIYKMVSVGLCPPLSGQIGVDCQVRPPKPGDESYPLWKKET
DTIHAALASRTRTMSERLNSLPGISCVNSPGALYLYPKVHLSDRAIEAARKVGKEPDAFY
AMKLLDETGICVVPGSGFGQKVGHWHYRLTCLCPGVDDYVDALANFHKRFIAEYGAAEE

BLAST