GenomeNet

>scm:SCHCODRAFT_61980 hypothetical protein; K00814 alanine transaminase [EC:2.6.1.2] (A)
MRPLSTSDLNPAILKVEYAVRGELAIKAEEYRKRLALGGEHGLPFDKVISSNIGNPQQKG
LDQPPITFIRQVAALCEWPALEELAPNAFPKDVIARARELREEIGSVGAYSHSQGVPLIR
QSVANFIEERDGYPANPDHIFLTGGASAGVSLLISMLITPPNTGILIPIPQYPLYTATLA
QHHGVPLPYHLDEASGWSTSLHEIEATLEHPQHAEITPKALVIINPGNPTGALLDEATQE
KLVHLCEKHNLVLLADEVYQTNLHRPDEHPFVSFKQIVSRMKSKVPLVSFHSISKGVTGE
CGRRGGYFECVNFPDDILALIYKMVSVGLCPPLSGQIGVDCQVRPPKPGDESYPLWKKET
DTIHAALASRTRTMSERLNSLPGISCVNSPGALYLYPKVHLSDRAIEAARKVGKEPDAFY
AMKLLDETGICVVPGSGFGQKVGHWHYRLTCLCPGVDDYVDALANFHKRFIAEYGAAEE

BLAST