GenomeNet

>scm:SCHCODRAFT_74617 hypothetical protein; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MFRPTLRKCLLRPHRSFSTTAPARKVVATNPVKAQEVPSWASGKYPLIEHEYDAVVVGAG
GAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
DWLGDQDAIHYMCREAPKTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKYGKGGQAYRCA
AAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNLEDGTLHRFRSH
KTVLATGGYGRAYFSCTSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEG
SRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHCYLQLSH
LPAEILHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVITVDENGKD
KVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIEETLTPGKPHKKIPDEAG
IESIEFLDQIRKADGPIPTAKIRLDLQKAMQSDAAVFRTQESLDEGVQKVKQIYETYKDV
GIKDRSMIWNSDLVETLELRNLLQCAVQTITSAAARKESRGAHAREDFPERDDESWMKHT
LSFQNDSTKPDVKLSYRGVIDKTLDENECKAVPPFKRVY

BLAST