GenomeNet

>scm:SCHCODRAFT_76992 glycosyltransferase family 3 protein; K00693 glycogen(starch) synthase [EC:2.4.1.11] (A)
MASTGMRNVSNPLLFESAWEVANKVGGIYTVIKTKVPVTVAEYGDRYTLMGPLSYKSAPM
EVEAVYPVPEGSVPKEEVPPAVKDTLDSMRAQGVKSLYGRWLIEGSPKVILFDTGSMYHR
LDEWKADLWNLAGIPTPPSDHETNETIVFGYLVAWFLGEFVARETDNAVIAAFHEWQAGL
AIPLCRKRHLDLTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIER
SAAHCADVFTTVSHITAYEAEHLLKRKPDGVVPNGLNVKKFQAMHEFQNLHSTSKEKINE
FVRGHFYGHLDFDLDNTLYFFTAGRYEYRNKGVDMFIESLARLNFQLQKAQSKTTVVAFI
IMPAATNSYTIEALKGQAVTKQLRDTVREIESRVGQRLFDHASRFHGGTNMASNAPIPTE
SLLSDEDMVLLKRRIFALKRNSLPPITTHNMADDANDPILNQIRRVQLFNNASDRVKIVF
HPDFLNANNPILGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCF
MQDLIERPADEGCYIVDRRMQSVEDSVNQLTDCMFAFCNKTRRQRINQRNRVERLSPLLD
WKNLGIEYSKSRMLALRRAYPDAFYSAEGEGTFDDVGDYFSVERATLSVPASPRLRGAAT
PGDLGTLTEEMQSLSTSDYRGQAWPSMEDEEDSYPFPLVMKVRSRSGSVMSGASTPGGGA
FRSLSEGDLERADAALSKVNGRAE

BLAST