GenomeNet

>scm:SCHCODRAFT_76992 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) glycosyltransferase family 3 protein (A)
MASTGMRNVSNPLLFESAWEVANKVGGIYTVIKTKVPVTVAEYGDRYTLMGPLSYKSAPM
EVEAVYPVPEGSVPKEEVPPAVKDTLDSMRAQGVKSLYGRWLIEGSPKVILFDTGSMYHR
LDEWKADLWNLAGIPTPPSDHETNETIVFGYLVAWFLGEFVARETDNAVIAAFHEWQAGL
AIPLCRKRHLDLTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIER
SAAHCADVFTTVSHITAYEAEHLLKRKPDGVVPNGLNVKKFQAMHEFQNLHSTSKEKINE
FVRGHFYGHLDFDLDNTLYFFTAGRYEYRNKGVDMFIESLARLNFQLQKAQSKTTVVAFI
IMPAATNSYTIEALKGQAVTKQLRDTVREIESRVGQRLFDHASRFHGGTNMASNAPIPTE
SLLSDEDMVLLKRRIFALKRNSLPPITTHNMADDANDPILNQIRRVQLFNNASDRVKIVF
HPDFLNANNPILGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCF
MQDLIERPADEGCYIVDRRMQSVEDSVNQLTDCMFAFCNKTRRQRINQRNRVERLSPLLD
WKNLGIEYSKSRMLALRRAYPDAFYSAEGEGTFDDVGDYFSVERATLSVPASPRLRGAAT
PGDLGTLTEEMQSLSTSDYRGQAWPSMEDEEDSYPFPLVMKVRSRSGSVMSGASTPGGGA
FRSLSEGDLERADAALSKVNGRAE

BLAST