GenomeNet

>sco:SCO4562 K00330 NADH-quinone oxidoreductase subunit A [EC:1.6.5.3] | (RefSeq) nuoA, SCD16A.21c; NADH dehydrogenase subunit A (A)
MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK
YYLTAMLFIIFDIEIVFLYPWAVTFDALGIFGLVEMLLFVLTVFVAYAYVWRRGGLEWD

BLAST