GenomeNet

>sco:SCO6709 SC4C6.19; hypothetical protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MAEAVELEAGGRSVRLSSPGKVFFPEHGYTKLDVARYYQAVAPGVLRALRERPTTLQRYP
DGITGEWFYQKRAPKGMPDWIPTAHITFPSGRSADEMCPTEEAAVLWAAQYGTLTFHPWP
VRRDDVDHPDELRIDLDPQPGTDYDDAARAAHELRAVLEEFGGLRGWPKTSGGRGIHVFV
PIEPRWTFTQVRRAAIAVGREMERRMPERVTIKWWKEERGERIFIDYNQTARDRTIASAY
SVRPRPNAPVSAPLTWDEVGVAHPRDFDITTMPARFAELGDVHAGMDDTRYSLDALLELA
TKDEHDHGLGDLPYPPEYPKMPGEPSRVQPSRARKKAPGPD

BLAST