GenomeNet

>sco:SCO6709 SC4C6.19; hypothetical protein (A)
MAEAVELEAGGRSVRLSSPGKVFFPEHGYTKLDVARYYQAVAPGVLRALRERPTTLQRYP
DGITGEWFYQKRAPKGMPDWIPTAHITFPSGRSADEMCPTEEAAVLWAAQYGTLTFHPWP
VRRDDVDHPDELRIDLDPQPGTDYDDAARAAHELRAVLEEFGGLRGWPKTSGGRGIHVFV
PIEPRWTFTQVRRAAIAVGREMERRMPERVTIKWWKEERGERIFIDYNQTARDRTIASAY
SVRPRPNAPVSAPLTWDEVGVAHPRDFDITTMPARFAELGDVHAGMDDTRYSLDALLELA
TKDEHDHGLGDLPYPPEYPKMPGEPSRVQPSRARKKAPGPD

BLAST