GenomeNet

>sco:SCO6709 no KO assigned | (RefSeq) SC4C6.19; hypothetical protein (A)
MAEAVELEAGGRSVRLSSPGKVFFPEHGYTKLDVARYYQAVAPGVLRALRERPTTLQRYP
DGITGEWFYQKRAPKGMPDWIPTAHITFPSGRSADEMCPTEEAAVLWAAQYGTLTFHPWP
VRRDDVDHPDELRIDLDPQPGTDYDDAARAAHELRAVLEEFGGLRGWPKTSGGRGIHVFV
PIEPRWTFTQVRRAAIAVGREMERRMPERVTIKWWKEERGERIFIDYNQTARDRTIASAY
SVRPRPNAPVSAPLTWDEVGVAHPRDFDITTMPARFAELGDVHAGMDDTRYSLDALLELA
TKDEHDHGLGDLPYPPEYPKMPGEPSRVQPSRARKKAPGPD

BLAST