GenomeNet

>sco:SCO7355 SC9H11.09c; hypothetical protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MDGEDDGLRDYHGKRDFGRTGEPAGPGAPGEGGAPGGDGPPRFVVQIHDASTLHFDFRLQ
VADVLKSWSVPKGPSADPRDKRLAVPTEDHPLEYEEFEGVIPAGEYGGGTVIVWDHGTYE
PLSHDRRGRPVDFAESLAHGHARFRLHGAKLRGEYALTRFRGGPDGDAGADAAWLLVKTA
GGGRGHGTPDPRRARSARTGRTLARVAAEHGEE

BLAST