GenomeNet

>sco:SCO7355 no KO assigned | (RefSeq) SC9H11.09c; hypothetical protein (A)
MDGEDDGLRDYHGKRDFGRTGEPAGPGAPGEGGAPGGDGPPRFVVQIHDASTLHFDFRLQ
VADVLKSWSVPKGPSADPRDKRLAVPTEDHPLEYEEFEGVIPAGEYGGGTVIVWDHGTYE
PLSHDRRGRPVDFAESLAHGHARFRLHGAKLRGEYALTRFRGGPDGDAGADAAWLLVKTA
GGGRGHGTPDPRRARSARTGRTLARVAAEHGEE

BLAST