GenomeNet

>scs:Sta7437_4065 D-alanine--D-alanine ligase domain protein; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MTTSKIFSTDRLESSLQTPSLSVLHLVGSAVSQFYYKLSLIYAREVVQPAKVRSYYAVVH
PDGLWQLGESLDKLSAKIPFPTAIARLPQVDVVVPHMFCFPGMTSYRALFEDIVGIPVVG
SRAECNALATNKSHTRNIVSSVGVRIAKAQQFKRGDSLTINLPFVVKPNSEDNSMGITLV
KQESEIETALQIGFEYDDVLLIEEYIPGRELRVGVIEKEEELYVLPAIEYLLTEDKPIRT
VDSKLGTKSDGMLFRQPVNIACPAKISPELWDKLAEAVKNAHCALGCRDYSLYDFRIHSE
TQEPYLLESCSFWSFINASVLSRMLEADNQKLEEVALMLWNNAAKRTRVACGSLFKYTNA
DHN

BLAST