GenomeNet

>sct:SCAT_4622 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; Thymidine kinase (EC:2.7.1.21) (A)
MSELVYFCGTMDCGKSTLALQIEHNRSARGLHGMIFTRNDRAGTGVLSSRLGLSTKAVEA
GDDLDFYVHVVDHLSGGGRVDYVIADEAQFFTPEQVDQLARVVDDLGLDVYAFGITTDFR
TRLFPGSARLVELADRIEVLQVEALCWCGARATHNARTVDGRMVVEGAQVVVGDVNGSAG
EVGYEVLCRRHHTRRMTAATARAAALSPDVLPVDTPAARAMEPVPDA

BLAST