GenomeNet

>sct:SCAT_5457 ligD; DNA polymerase LigD, ligase domain; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MPDRVTPMLAVLSDRRHFDDTWVLERKLDGVRAIGFRDGDTVRLASRTGQRLENTYPEIV
RALADQPQRAFVVDGEIVALDDGRTSFERLQRRMQLTRPSAALASGVAVTYFLFDLLHLA
GHDTTGLPLRSRKELLREAVRYTGPLRYTEHHTATGDAGQLLDAACAQGWEGLIAKRADG
RYQQRRSSDWLKLKCLTAQEFVVGGYTEPAGSRAGFGALLLGYHQGGRLRYAGKVGTGYD
TATLRRLRGLLDERGLTEPPFAEPVRERGAHWVRPDLVVQVAFTEWTRDGRLRAPRYLGL
RQDKRPERVVREG

BLAST