GenomeNet

>sct:SCAT_5457 no KO assigned | (GenBank) ligD; DNA polymerase LigD, ligase domain (EC:6.5.1.1) (A)
MPDRVTPMLAVLSDRRHFDDTWVLERKLDGVRAIGFRDGDTVRLASRTGQRLENTYPEIV
RALADQPQRAFVVDGEIVALDDGRTSFERLQRRMQLTRPSAALASGVAVTYFLFDLLHLA
GHDTTGLPLRSRKELLREAVRYTGPLRYTEHHTATGDAGQLLDAACAQGWEGLIAKRADG
RYQQRRSSDWLKLKCLTAQEFVVGGYTEPAGSRAGFGALLLGYHQGGRLRYAGKVGTGYD
TATLRRLRGLLDERGLTEPPFAEPVRERGAHWVRPDLVVQVAFTEWTRDGRLRAPRYLGL
RQDKRPERVVREG

BLAST