GenomeNet

>sct:SCAT_5459 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) conserved protein of unknown function (A)
MPDRQAVEVDGHRLVLVNLDRLLFPVSGHTKAQLLHYYAQVAEVLLPHATGRPASFVRAP
DGPGGQTWYAKRPPPGLPDWVTLAEVPGSEGPAPHVVVDSTAALMAMANLAAFEVHVPQW
TARTGPDGHDRLVLDLDPGPGADLVLCCTVAQRLRQMLADDGLTAYPVSSGSKGLHLYAP
LEPAPERAVSGYARSLAQRMQAEHPGLVTASMDRSIRPGKVFIDWSQNATHKTTACPYTL
RLHERPRVAAPVGWDEIAGCAAPERLVLSPEQVVERVARLGDPLAELAARTHAAPLPR

BLAST