GenomeNet

>sct:SCAT_5571 conserved protein of unknown function (A)
MSPRSGRPELAEYRRKRDFAATAEPAGGEDAGTPGGDGRFVVQLHDASTRHFDFRLESRG
VLKSWAVPKGPSSDPRDKRLAVPTEDHPLECRDVEGVIGEGYGAGTVLVWNTGTYRNLSR
RHGEPVPFADALDAGHVSFWLDGGKLRGGYALTRLRDGAWLLVKERDRYAHGGGSPSPER
VRSARTHRTLRQIAREEGG

BLAST