GenomeNet

>sct:SCAT_5571 no KO assigned | (GenBank) conserved protein of unknown function (A)
MSPRSGRPELAEYRRKRDFAATAEPAGGEDAGTPGGDGRFVVQLHDASTRHFDFRLESRG
VLKSWAVPKGPSSDPRDKRLAVPTEDHPLECRDVEGVIGEGYGAGTVLVWNTGTYRNLSR
RHGEPVPFADALDAGHVSFWLDGGKLRGGYALTRLRDGAWLLVKERDRYAHGGGSPSPER
VRSARTHRTLRQIAREEGG

BLAST