GenomeNet

>sct:SCAT_5571 hypothetical protein (A)
MSPRSGRPELAEYRRKRDFAATAEPAGGEDAGTPGGDGRFVVQLHDASTRHFDFRLESRG
VLKSWAVPKGPSSDPRDKRLAVPTEDHPLECRDVEGVIGEGYGAGTVLVWNTGTYRNLSR
RHGEPVPFADALDAGHVSFWLDGGKLRGGYALTRLRDGAWLLVKERDRYAHGGGSPSPER
VRSARTHRTLRQIAREEGG

BLAST