GenomeNet

>scy:SCATT_54560 DNA polymerase LigD ligase subunit; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MDAAHHRRPRPDDPVPDRVTPMLAVLSDRRHFDDTWVLERKLDGVRAIGFRDGDTVRLAS
RTGQRLENTYPEIVRALADQPQRAFVVDGEIVALDDGRTSFERLQRRMQLTRPSAALASG
VAVTYFLFDLLHLAGHDTTGLPLRSRKELLREAVRYTGPLRYTEHHTATGDAGQLLDAAC
AQGWEGLIAKRADGRYQQRRSSDWLKLKCLTAQEFVVGGYTEPAGSRAGFGALLLGYHQG
GRLRYAGKVGTGYDTATLRRLRGLLDERGLTEPPFAEPVRERGAHWVRPDLVVQVAFTEW
TRDGRLRAPRYLGLRQDKRPERVVREG

BLAST