GenomeNet

>scy:SCATT_54560 DNA polymerase LigD ligase subunit (A)
MDAAHHRRPRPDDPVPDRVTPMLAVLSDRRHFDDTWVLERKLDGVRAIGFRDGDTVRLAS
RTGQRLENTYPEIVRALADQPQRAFVVDGEIVALDDGRTSFERLQRRMQLTRPSAALASG
VAVTYFLFDLLHLAGHDTTGLPLRSRKELLREAVRYTGPLRYTEHHTATGDAGQLLDAAC
AQGWEGLIAKRADGRYQQRRSSDWLKLKCLTAQEFVVGGYTEPAGSRAGFGALLLGYHQG
GRLRYAGKVGTGYDTATLRRLRGLLDERGLTEPPFAEPVRERGAHWVRPDLVVQVAFTEW
TRDGRLRAPRYLGLRQDKRPERVVREG

BLAST