GenomeNet

>scy:SCATT_54580 hypothetical protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MPPMPDRQAVEVDGHRLVLVNLDRLLFPVSGHTKAQLLHYYAQVAEVLLPHATGRPASFV
RAPDGPGGQTWYAKRPPPGLPDWVTLAEVPGSEGPAPHVVVDSTAALMAMANLAAFEVHV
PQWTARTGPDGHDRLVLDLDPGPGADLVLCCTVAQRLRQMLADDGLTAYPVSSGSKGLHL
YAPLEPAPERAVSGYARSLAQRMQAEHPGLVTASMDRSIRPGKVFIDWSQNATHKTTACP
YTLRLHERPRVAAPVGWDEIAGCAAPERLVLSPEQVVERVARLGDPLAELAARTHAAPLP
R

BLAST