GenomeNet

>sda:GGS_0875 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; truncated thymidine kinase Tdk (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVVSSRIGMRREAV
PISSDMDVFTFIDQLEEKPYCVLIDESQFLSKQNVYDLARVVDKLNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGAQIQIGGNETYIPVC
RKHYFHPPVSTEQSVMTEKN

BLAST