GenomeNet

>sdg:SDE12394_05070 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVVSSRIGMRREAV
PISSDMDVFTFIDQLEEKPYCVLIDESQFLSKQNVYDLARVVDKLNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTENEKPVYEGAQIQIGGNETYIPVC
RKHYFHPPVSTEQSVMTEKK

BLAST