GenomeNet

>sdn:Sden_1800 alpha amylase, catalytic region (EC:3.2.1.1); K01176 alpha-amylase [EC:3.2.1.1] (A)
MAASNTKIIIKKRTSFRLTFALVAGLSALGLSSSASSAENGVMMQYFHWYTPADGKLWTQ
VQQESSALAAAGFTALWLPPAYKGASGALDVGYGVYDMYDLGEFNQKGAVRTKYGTKSQY
VSAINTAHTQGLQVYGDLVFNHRGGADATESVTAVRVARDNRDREFGADVQIDAWTRFDF
TARQNQHSAFKWRWYHFDGVDWAQNLTESNIFKFRGTGKGWDWEVDTENVNYDYLMYADL
DFNHPEVVQELKDWGDWYLSQTQVDGFRLDAIKHIRYEFFNDWLDYMRANSGKTLFTVGE
FWSYDTAKLHNYINKTSGRMSLFDAPLHLNFHQASTANGNYDMRRIWDNSLMKEQPNLAV
TLVENHDTQACQALASPVNDWFKPLAYAFILLRSQGYPNVFYADYYGANYTSSDNSCNNS
VITMVSHKTKIDQLLKARKDYAYGPQIDYLDHWDIIGWTRLGDTSHPKAMAVIMSDGASG
TKWMNVNRTSTRFMDITGHRSETVTTNADGWGQFPVNGGSYSVWVEQATSTSTVAVTFNC
NNGVTYAGQDVYVVGNQANLGNWNTAAAIKLSPTGYPSWSGTINLPMSKAIEWKCIKKSA
TEVVWQGGGNNTYTTPSSGVGSTSASF

BLAST