GenomeNet

>sdr:SCD_n02850 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) cbbM; ribulose bisphosphate carboxylase, large subunit (EC:4.1.1.39) (A)
MDQSNRYADLSLKEEDLIKGDNHILVAYHMQPATGYGYLEVAAHIAAESSTGTNVEVSTT
DDFTKGVDALVYFIDEAKGIMKVAYPNDLFDRNVTDGRAMLVSFLTLAIGNNQGMGDVKH
LQMQDFYVPWSMLRLYDGPAKDITDLWDILGRPRINGGYIAGTIIKPKLGLRPEPFAKAA
YQFWLGGDFIKNDEPQGNQVFCPTKKVIPLVYDSMKRAMDETGQAKLFSANITADDHYEM
LARADYILETFGPDANKVAFLVDGYVGGPGMITTARRQYPGQYLHYHRAGHGAITSPSAV
RGYTAFVLSKMSRLQGASGIHVGTMGYGKMEGGKDDRNIAYMIERDSADGPYYHQEWHGM
KPTTPIISGGMNALRLPGFFENLGHGNVINTSGGGSYGHIDSPAAGAISLRQSYECWKAG
ADPIEFAKEHKEFARAFESFPGDADKIFPGWREKLGVHK

BLAST