GenomeNet

>sds:SDEG_0191 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (GenBank) phosphoglycerate mutase family protein (A)
MANSRSKSITTLTDLRERKLSDEWVKDFNEIAQKQWEDFNFKLPNGESLKEVQERNIKTL
DHILSESKNQTVVIGTHGTALSTIINDYKPEFRYEAFNAIKHVFPWVVRFEFEGEALRKL
GISLGIGK

BLAST