GenomeNet

>sds:SDEG_0899 tdk; thymidine kinase Tdk (EC:2.7.1.-); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVVSSRIGMRREAV
PISSDMDVFTFIDQLEEKPYCVLIDESQFLSKQNVYDLARVVDKLNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGAQIQIGGNETYIPVC
RKHYFHPPVSTEQSVMTEKK

BLAST