GenomeNet

>sed:SeD_A4662 glutathione S-transferase, N-domain; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MLTVHHLNQSRSQRILWALEELALPYQIVRYQREKTMLAPPALKKVHPLGKSPVIEDHGM
VIAESGAILEYLQDTYDNIGRFKPADAQGKQHYRFWLHYAEGSLMPLLLMRLLFTSLGKP
PVPLGLRTLGGVIGKGAQKAYLNPQLETHARFIDGHLANHPWFAGEQLSMADIQMSFPLF
ALLARGGIAHLDHINAWKARVEMRPAWQRAIQQGGPFTISGG

BLAST