GenomeNet

>sed:SeD_A4662 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase, N-domain (A)
MLTVHHLNQSRSQRILWALEELALPYQIVRYQREKTMLAPPALKKVHPLGKSPVIEDHGM
VIAESGAILEYLQDTYDNIGRFKPADAQGKQHYRFWLHYAEGSLMPLLLMRLLFTSLGKP
PVPLGLRTLGGVIGKGAQKAYLNPQLETHARFIDGHLANHPWFAGEQLSMADIQMSFPLF
ALLARGGIAHLDHINAWKARVEMRPAWQRAIQQGGPFTISGG

BLAST