GenomeNet

>sen:SACE_3549 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA ligase (ATP) (A)
MAGSDVTVEVSGRRLKLSNLDKVLYPVTGFTKRDVVDYYQRVAPAMLPHLRDRAATLIRF
PDGVGGFSFYEKNVGRHAPDWLPTVALISGAEGTGRALNHHVVVNDLPTLVWTANLAALE
LHVLQWKVDADGTRNPPDILVFDLDPGEPATIVDCCRVAELLHDVLRAEGLRPYPKTSGS
KGLQLYCPVRVDSPKRTSEYAKEIAQHMQAEHPESVVAKMAKAEREGKVFIDWSQNNTAK
TTVAPYSLRARARPTVSTPVTWDEVRGCTKPDELVFTSDDVLRRLDRHGDLMADMEDSPT
PL

BLAST