GenomeNet

>sep:SE1717 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase (A)
MYETYHSGWIETITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NEIEAINISTAQEILNHKLEEVNVIGIDEVQFFEDDIVNIVEKLAENGHRVIVAGLDMDF
RGEPFKPMPKLLAVSEHITKLQAVCSVCGSPSSRTQRLINGEPAKVDDPIILVGANESYE
PRCRAHHIVAPSENEKEEM

BLAST