GenomeNet

>seq:SZO_05310 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) glycosyl hydrolase family protein (A)
MLFNPIGKEQIRKYAIKKLSVGVASVCVGIGLAAGLPVVVYADDVSEVSLQQPTKAAVTE
ISHEQEPQATDTDSEALVVSEETTVDEAVVANAVTSNAADQTADEEKSNAPVELNKVANG
GFDNDYVSNKNQWQYREGGHSVLTTENNNSYAEVTSGTLDEHILQKVSTTVGKTYTLEAD
VKVEADTPHNGLYLTAKESNHNLQGPVIKEVSLTDTDGTWSHIKLSFTATTSETFVGLVK
RLEASSPETLAASASIDNVSVVEENDYELIWQDEFSGDQLNQENWGYELGSIRGNEQQHY
TDSTENIYLENGNLVLNVTERKGEDRYANPRGGTSARQVIYDSGSVRTVGKQEFLYGRIE
ARAKLPKGKGAFPAFWTLGADFTLDGDIASTQGYGWPSTGELDIMELIGAPNGEHEGELA
EGDQSNKTVYGTPHFYYVKGDADKDGSYSPTALGGNLTLSDDFYDDYHIFGINWYPDKIE
WYVDGIVYNTMYLTGDERLEAAAAAFNKPQYLQFNLATGGNWSKNAGYYLASDETAFVID
YVRYYQDAEQKAASEAYYASQPDLKGVKDLTMLEGTSPDLAQAVTTDQEGYVVDFSVENE
YLFTNKGGNTNAALQAAGRDDLSALSELAPGIYNIYYSAVPYNADLGSTVTPTAKIAREV
AILTVLPKEGLIGKKGEPLSTVALPANWQWVTPEEILGSAEHYQIKYTTEGGRAIYTSIE
ASYISDQPISDQASILVDLGNAILDATAEKAAVTDDEALSKLDDVMSLNQGTVTIRYRLD
TADTTVRSSSPLALLSISNQASANEYASFFIEPKNNKIGLEFKGAEVPIVKVGSGFNLLT
NSDWQTISYVFTGSRLKIYLNGDLYGEADFAGFMKQLPWKASADTLTIGGLKRTYDGESV
LHWGLKGLVDQVLIDTDVYDLTDIAKAHQSTLRPVTGEKTNVWDKYDEGVFEYRIPSVVK
TPSGTLIAAADARKKHYNDWGDVATVVRISHDDGKTWSNNITVLDMPTQPYFTTQYSLAD
WNTNMTQSAFSIDSTLLTDASGKLYLLVDVFPESQGAVASKAGSGYELINGQYYLNLYDF
DNNKYTVREGGIVYDQNGHQTDMYVDEGNFETAFSTRGNLYQTEAGEDILLGNIYLRSGR
TKQGITREGSQTAPLFTYMTSFLWLLTSEDEGQTWSTPLDITPQIKEDWMGFLGTGAAAG
IEIDAVNAEGEQVKRLVFPIYYTNQQNATSASLGRQSSANIFSDDGGQTWQRGESPNDGR
IYGHNQQTTSKDFDTSVTELTENQIIQLNNGHLLQFMRNTGKTIVIARSTDYGATWEDNP
TVTDLPEPYVNLSAIHMMVDGKEYVVLSNPLGEPSGEQLTIRNQRMKGILRVGEVLEDDS
INWVASTIFEPKRFAYSSLVQLDDERVGLLYEYSGQITYSTFNIKQMISDQFREDKAEIE
EVTITSAAPKQNGKASITIQMTFNQPMFILGDRQLAVTVNGVDKLASYVSGDGTDTAIFE
LSLESMPEGPITVLPQFDHTIVETKYGIRLTDDKAYTVSYPAAVTA

BLAST