GenomeNet

>seq:SZO_09330 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) putative thymidine kinase (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAV
PISSDMDIFAFIAELQEKPYCVLIDECQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTEHGKPVYEGAQIQIGGNETYIPVC
RKHYFHPPI

BLAST